bioinformatics Linearizing a FASTA sequence. Linearize FASTA sequences from Uniprot


download and linearize the 10 first FASTA sequences from UniProt:

$ curl -s  "" |\
  gunzip -c |\
  awk '/^>/ {printf("%s%s\t",(N>0?"\n":""),$0);N++;next;} {printf("%s",$0);} END {printf("\n");}'  |\

>sp|Q6GZX1|004R_FRG3G Uncharacterized protein 004R OS=Frog virus 3 (isolate Goorha) GN=FV3-004R PE=4 SV=1    MNAKYDTDQGVGRMLFLGTIGLAVVVGGLMAYGYYYDGKTPSSGTSFHTASPSFSSRYRY